Client lädt einfach neuen Core...

[FlyingStep]

Hallo Leute!

Ich glaube, ich habe ein Problem. Nachdem ich gestern ein Ergebnis für GAH hochgeladen hatte fing der Client plötzlich an einen neuen oder anderen Core zu laden. Nachdem er den Download abgeschlossen hatte, fing er an etwas ganz anderes zu berechnen. Der Log sieht folgendermassen aus:

16:09:54] [SPG] Designing protein sequence 30 of 30
[16:11:07] [SPG] 10.0
[16:12:19] [SPG] 20.0
[16:13:38] [SPG] 30.0
[16:14:52] [SPG] 40.0
[16:16:10] [SPG] 50.0
[16:17:29] [SPG] 60.0
[16:18:42] [SPG] 70.0
[16:19:59] [SPG] 80.0
[16:21:22] [SPG] 90.0
[16:22:38] [SPG] 100.0
[16:22:38] [SPG] Writing current.xyz
[16:22:38] [SPG] Sequence 30 completed:
[16:22:38] RLYVAKWYWPARGRATLTVYPGEKLVVLTTDNNNIWVYITIPQGTGWLPA . . .
[16:22:38] Iterations: 600 of 600
[16:22:39] Finished
[16:22:40] [SPG] Design complete
[16:22:40] [SPG] completed successfully
[16:22:40]
[16:22:40] Finished Work Unit
[16:22:40] work_hdr.len_arcfile: 112200
[16:22:41] Leaving Run
[16:22:45] - Writing 112712 bytes of core data to disk.
[16:22:45] end (WriteWorkResults)
[16:22:45] - Shutting down core
[16:22:45]
[16:22:45] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[16:22:48] CoreStatus = 64 (100)
[16:22:48] Sending work to server


[16:22:48] + Attempting to send results
[16:22:48] - Reading file work/wuresults_02.dat from core
[16:22:48] (Read 112712 bytes from disk)
[16:22:52] Connecting to http://171.64.122.125:8080/
[16:23:07] Initial: 0000 + Results successfully sent
[16:23:08] Thank you for your contribution to Folding@home.
[16:23:08] + Starting local stats count at 1
[16:23:12] Trying to send all finished work units


[16:23:12] + Attempting to send results
[16:23:12] - Reading file work/wuresults_01.dat from core
[16:23:12] (Read 107762 bytes from disk)
[16:23:12] Connecting to http://171.64.122.125:8080/
[16:23:34] Initial: 0000 + Results successfully sent
[16:23:34] Thank you for your contribution to Folding@home.
[16:23:34] + Number of Units Completed: 2
[16:23:34] + Sent 1 completed units to the server
[16:23:34] + Attempting to get work packet
[16:23:34] - Connecting to assignment server
[16:23:34] Connecting to http://assign.stanford.edu:8080/
[16:23:38] Initial: 40AB - Successful: assigned to (171.64.122.124).
[16:23:38] + News From Folding@Home: Welcome to Folding@Home
[16:23:38] Loaded queue successfully.
[16:23:38] Connecting to http://171.64.122.124:8080/
[16:23:42] Initial: 0000 - Receiving payload (expected size: 352323)
[16:25:24] + Received work.
[16:25:24] + Connections closed: You may now disconnect
[16:25:24]
[16:25:24] + Processing work unit
[16:25:24] Core required: FahCore_78.exe
[16:25:24] Core not found.
[16:25:24] - Core is not present or corrupted.
[16:25:24] - Attempting to download new core...
[16:25:24] + Downloading new core: FahCore_78.exe
[16:25:24] Downloading core (/~pande/Win32/x86//Core_78.fah from www.stanford.edu)
[16:25:46] Initial: AFDE + 10240 bytes downloaded
[16:25:51] Initial: 43D7 + 20480 bytes downloaded
[16:25:54] Initial: 4541 + 30720 bytes downloaded
[16:25:57] Initial: 326A + 40960 bytes downloaded
[16:26:00] Initial: CD18 + 51200 bytes downloaded
[16:26:04] Initial: CFF4 + 61440 bytes downloaded
[16:26:08] Initial: 6A61 + 71680 bytes downloaded
[16:26:11] Initial: 7F7B + 81920 bytes downloaded
[16:26:17] Initial: 30EB + 92160 bytes downloaded
[16:26:20] Initial: 495F + 102400 bytes downloaded
[16:26:28] Initial: 456F + 112640 bytes downloaded
[16:26:28] Initial: 3543 + 122880 bytes downloaded
[16:26:32] Initial: A66B + 133120 bytes downloaded
[16:26:36] Initial: 881B + 143360 bytes downloaded
[16:26:39] Initial: 157E + 153600 bytes downloaded
[16:26:43] Initial: 2C49 + 163840 bytes downloaded
[16:26:47] Initial: 4316 + 174080 bytes downloaded
[16:26:50] Initial: BE62 + 184320 bytes downloaded
[16:26:53] Initial: 40EA + 194560 bytes downloaded
[16:26:56] Initial: E830 + 204800 bytes downloaded
[16:27:01] Initial: 47E0 + 215040 bytes downloaded
[16:27:07] Initial: 63EB + 225280 bytes downloaded
[16:27:07] Initial: D654 + 235520 bytes downloaded
[16:27:13] Initial: 8E02 + 245760 bytes downloaded
[16:27:13] Initial: 2DE2 + 256000 bytes downloaded
[16:27:14] Initial: B532 + 266240 bytes downloaded
[16:27:17] Initial: FF5E + 276480 bytes downloaded
[16:27:20] Initial: 8D46 + 286720 bytes downloaded
[16:27:23] Initial: 4348 + 296960 bytes downloaded
[16:27:26] Initial: 01F7 + 307200 bytes downloaded
[16:27:29] Initial: 70CC + 317440 bytes downloaded
[16:27:32] Initial: 3397 + 327680 bytes downloaded
[16:27:35] Initial: D545 + 337920 bytes downloaded
[16:27:37] Initial: 27FD + 348160 bytes downloaded
[16:27:40] Initial: 35CE + 358400 bytes downloaded
[16:27:43] Initial: 398E + 368640 bytes downloaded
[16:27:46] Initial: 8B19 + 378880 bytes downloaded
[16:27:49] Initial: 8082 + 389120 bytes downloaded
[16:27:52] Initial: 94D1 + 399360 bytes downloaded
[16:27:55] Initial: 0C79 + 409600 bytes downloaded
[16:27:59] Initial: 68C0 + 419840 bytes downloaded
[16:28:02] Initial: 068B + 430080 bytes downloaded
[16:28:05] Initial: FAA3 + 440320 bytes downloaded
[16:28:08] Initial: 18AB + 450560 bytes downloaded
[16:28:10] Initial: CF71 + 460800 bytes downloaded
[16:28:14] Initial: 5A2D + 471040 bytes downloaded
[16:28:17] Initial: 90D5 + 481280 bytes downloaded
[16:28:20] Initial: 8EF2 + 491520 bytes downloaded
[16:28:23] Initial: 7693 + 501760 bytes downloaded
[16:28:25] Initial: 4CD6 + 512000 bytes downloaded
[16:28:28] Initial: A10D + 522240 bytes downloaded
[16:28:31] Initial: 84D0 + 532480 bytes downloaded
[16:28:35] Initial: 50FB + 542720 bytes downloaded
[16:28:37] Initial: E86C + 552960 bytes downloaded
[16:28:42] Initial: 56A4 + 563200 bytes downloaded
[16:28:43] Initial: 5C4A + 573440 bytes downloaded
[16:28:47] Initial: 5645 + 583680 bytes downloaded
[16:28:50] Initial: C29A + 593920 bytes downloaded
[16:28:53] Initial: 6B25 + 603990 bytes downloaded
[16:28:56] Verifying core Core_78.fah...
[16:28:56] Signature is VALID
[16:28:56] Created: Wednesday April 10, 2002 00:01:22 UTC
[16:28:56] Signed: Thursday April 3, 2003 00:01:22 UTC
[16:28:56]
[16:28:56] Trying to unzip core FahCore_78.exe
[16:28:56] Decompressed FahCore_78.exe (1728512 bytes) successfully
[16:28:56] + Core successfully engaged
[16:29:01]
[16:29:01] + Processing work unit
[16:29:01] Core required: FahCore_78.exe
[16:29:01] Core found.
[16:29:01] Working on Unit 03 [October 22 16:29:01]
[16:29:01] + Working ...
[16:29:01] - Calling 'FahCore_78.exe -dir work/ -suffix 03 -lifeline 1680
'

[16:29:01]
[16:29:01] *------------------------------*
[16:29:01] Folding@home Gromacs Core
[16:29:01] Version 1.51 (September 25, 2003)
[16:29:01]
[16:29:01] Preparing to commence simulation
[16:29:01] - Looking at optimizations...
[16:29:01] - Created dyn
[16:29:01] - Files status OK
[16:29:01] - Go method
[16:29:02] - Expanded 351811 -> 1760809 (decompressed 500.4 percent)
[16:29:02] - Starting from initial work packet
[16:29:02]
[16:29:02] Project: 549 (Run 46, Clone 28, Gen 3)
[16:29:02]
[16:29:02] Assembly optimizations on if available.
[16:29:02] Entering M.D.
[16:29:08] Protein: p549_BBA5_pf
[16:29:08]
[16:29:08] Writing local files
[16:29:08] Extra 3DNow boost OK.
[16:29:10] Writing local files
[16:29:10] Completed 0 out of 500000 steps (0)
[16:29:18] ***** Got a SIGTERM signal (2) from OS

Folding@home Client Shutdown.


Das sieht mir doch nach einer Berechnung für FAH aus. Ich hatte aber bei der Installation explizit GAH als Core-Typ angegeben. Dasselbe ist auch bei meinem zweiten Client passiert. Die Clients laufen mit -local -verbosity 9 -forceasm. Der zweite hat zusätzlich noch -advmethods.
Hat jemand nen Dunst warum der Client das macht? (Verschwörung gegen mich??*g*)
Da bleibt mir wohl nichts anderes übrig, als die Client neu zu installieren, oder? Oder bin ich nur zu doof?

In Selbstzweifeln versinkend
Fly

[Pascal]

..
Da bleibt mir wohl nichts anderes übrig, als die Client neu zu installieren, oder? Oder bin ich nur zu doof?

Installier ihn ruhig neu. Von diesem plötzlichen Umschwenken auf F@H wurde schon mehrfach berichtet.

[Michael H.W. Weber]

Ganz ruhig. Der Client hat es für nötig erachtet, eine FAH WU zu berechnen. Dies hat folgenden Grund:

...Der zweite hat zusätzlich noch -advmethods.

Dieser Schalter zwingt dem Client Folding@home auf. Falls Du diesen Schalter beim anderen Client NICHT gesetzt hast, dieser aber ebenfalls auf FAH umschwenkte, muß dieser Client mehrfach erfolglos versucht haben, eine neue GAH WU zu laden. Als das nicht ging, lud er eine FAH WU (da gibt es MEHR Assignmentserver).
Um das Problem zu korrigieren, löschst Du einfach alles bis auf die "Fah3Console.exe" und startest noch einmal neu - oder Du startest den Client EINMAL mit -config und stellst sicher, dass die Präferenz wieder auf "gah" steht (schnellerer Weg). Das Vieh hat die Angewohnheit, sich nach solch Vorkommnis auf "no-pref" umzustellen. Dann bekommst Du fast nur noch FAH WUs wegen der Überzahl an FAH-Servern gegenüber den (beiden) GAH-Servern.

Michael.

[FlyingStep]

Vielen Dank für die prompte Hilfe! Habe jetzt beide Clients neu aufgesetzt und -advmethods deaktiviert. Aber für die Zukunft weiß ich ja jetzt was zu tun ist.
Ist aber schon seltsam, dass auch ohne -advmethods FAH geladen wird, oder?

Gruß
Fly

[Michael H.W. Weber]

Ist aber schon seltsam, dass auch ohne -advmethods FAH geladen wird, oder?

Das ist nicht seltsam, sondern gewollt und hat eigentlich die oben beschriebene Ursache einer Serverüberlastung.

Michael.